Vergleich

Recombinant Human Regulator of G-protein signaling 2(RGS2)

ArtNr CSB-EP019651HU-1
Hersteller Cusabio
Menge 1 mg
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Human (Homo sapiens)
Host E.coli
Konjugat/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKR TLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEF CEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQK RVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA
Citations A human gene encoding a putative basic helix-loop-helix phosphoprotein whose mRNA increases rapidly in cycloheximide-treated blood mononuclear cells.Siderovski D.P., Heximer S.P., Forsdyke D.R.DNA Cell Biol. 13:125-147(1994)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Cell growth-inhibiting gene 31 protein;G0/G1 switch regulatory protein 8
Lieferbar
Manufacturer - Targets
RGS2
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
40.4 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Signal Transduction
Relevance
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving th into their inactive GDP-bound form. May play a role in leukogenesis. Plays a role in negative feedback control pathway for adenylyl cyclase signaling. Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein.
Biologically Active
Not Test
Expression Region
1-211aa
Protein Length
Full Length
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form
Subcellular Location
Isoform 1: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 4: Cell membrane, Mitochondrion
Tissue Specificity
Expressed in acute myelogenous leukemia (AML) and in acute lymphoblastic leukemia (ALL).
Paythway
cGMP-PKGsignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen