« Zurück
Home /
Recombinant Human Regulator of G-protein signaling 2(RGS2)

Recombinant Human Regulator of G-protein signaling 2(RGS2)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP019651HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Signal Transduction
Target / Protein	RGS2
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P41220
AA Sequence	MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKR TLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEF CEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQK RVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-211aa
Protein length	Full Length
MW	40.4 kDa
Alternative Name(s)	Cell growth-inhibiting gene 31 protein; G0/G1 switch regulatory protein 8
Relevance	Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving th into their inactive GDP-bound form. May play a role in leukogenesis. Plays a role in negative feedback control pathway for adenylyl cyclase signaling. Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein.
References	A human gene encoding a putative basic helix-loop-helix phosphoprotein whose mRNA increases rapidly in cycloheximide-treated blood mononuclear cells.Siderovski D.P., Heximer S.P., Forsdyke D.R.DNA Cell Biol. 13:125-147(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form
Subcellular Location	Isoform 1: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Cytoplasm, Nucleus, nucleolus, SUBCELLULAR LOCATION: Isoform 4: Cell membrane, Mitochondrion
Tissue Specificity	Expressed in acute myelogenous leukemia (AML) and in acute lymphoblastic leukemia (ALL).
Paythway	cGMP-PKGsignalingpathway
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP019651HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen