« Zurück
Startseite /
Recombinant Human FAD synthase(FLAD1)

Recombinant Human FAD synthase(FLAD1)

ArtNr	CSB-EP854116HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MTSRASELSPGRSVTAGIIIVGDEILKGHTQDTNT FFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFS NRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPH PKLEAATKALGGEGWEKLSLVPSSARLHYGTDPCT GQPFRFPLVSVRNVYLFPGIPELLRRVLEGMKGLF QNPAVQFHSKELYVAADEASIAPILAEAQAHFGRR LGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYL TAR
Protein Familie	MoaB/Mog family; PAPS reductase family, FAD1 subfamily
Citations	Cloning, expression and characterization of a human FAD synthetase.Fischer M.J., Kempter K., Bacher A. Chen X.G., Li Y. Large-scale cDNA transfection screening for genes related to cancer development and progression.Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FAD pyrophosphorylaseFMN adenylyltransferaseFlavin adenine dinucleotide synthase 2 domains:Molybdenum cofactor biosynthesis protein-like regionFAD synthase region
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	70.2 kDa
General Research Areas	Metabolism
Relevance	Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.
Expression Region	1-490aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.
Subcellular Location	Isoform 1: Mitochondrion matrix, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm
Involvement in disease	Lipid storage myopathy due to flavin adenine dinucleotide synthetase deficiency (LSMFLAD)
Gene Names	FLAD1
Sequence Info	Full Length of Isoform 2
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP854116HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern