« Zurück
Startseite /
Recombinant Human Eukaryotic translation initiation factor 1(EIF1)

Recombinant Human Eukaryotic translation initiation factor 1(EIF1)

ArtNr	CSB-RP051144h-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRI QQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKD DQLKVHGF
Protein Familie	SUI1 family
Citations	Novel Upf2p orthologues suggest a functional link between translation initiation and nonsense surveillance complexes.Mendell J.T., Medghalchi S.M., Lake R.G., Noensie E.N., Dietz H.C.Mol. Cell. Biol. 20:8944-8957(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	A121;Protein translation factor SUI1 homologSui1iso1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	39.7 kDa
General Research Areas	Metabolism
Relevance	Necessary for scanning and involved in initiation site selection. Promotes the assbly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.
Expression Region	1-113aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.
Gene Names	EIF1
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-RP051144h-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern