Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP051144h-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Metabolism |
Uniprot ID |
P41567 |
Gene Names |
EIF1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRI QQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKD DQLKVHGF |
Expression Region |
1-113aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
39.7 kDa |
Alternative Name(s) |
A121; Protein translation factor SUI1 homologSui1iso1 |
Relevance |
Necessary for scanning and involved in initiation site selection. Promotes the assbly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. |
Reference |
Novel Upf2p orthologues suggest a functional link between translation initiation and nonsense surveillance complexes.Mendell J.T., Medghalchi S.M., Lake R.G., Noensie E.N., Dietz H.C.Mol. Cell. Biol. 20:8944-8957(2000) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. |
Protein Families |
SUI1 family |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.