Recombinant Human Eukaryotic translation initiation factor 1(EIF1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP051144h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P41567
Gene Names
EIF1
Organism
Homo sapiens (Human)
AA Sequence
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRI QQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKD DQLKVHGF
Expression Region
1-113aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
39.7 kDa
Alternative Name(s)
A121; Protein translation factor SUI1 homologSui1iso1
Relevance
Necessary for scanning and involved in initiation site selection. Promotes the assbly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.
Reference
Novel Upf2p orthologues suggest a functional link between translation initiation and nonsense surveillance complexes.Mendell J.T., Medghalchi S.M., Lake R.G., Noensie E.N., Dietz H.C.Mol. Cell. Biol. 20:8944-8957(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close