Vergleich

Recombinant Human Inactive tyrosine-protein kinase 7 (PTK7),partial

ArtNr CSB-YP622651HU-500
Hersteller Cusabio
Menge 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Human (Homo sapiens)
Host Yeast
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYW LLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQ CVARDDVTGEEARSANASFNIKWIEAGPVVLKHPA SEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLS DGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSA FGQACSSQNFTLSIADESFARVVLAPQDVVVARYE EAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHL RRA
Protein Familie Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily
Citations Colon carcinoma kinase-4 defines a new subclass of the receptor tyrosine kinase family.Mossie K., Jallal B., Alves F., Sures I., Plowman G.D., Ullrich A.Oncogene 11:2179-2184(1995)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Colon carcinoma kinase 4 ;CCK-4Protein-tyrosine kinase 7Pseudo tyrosine kinase receptor 7Tyrosine-protein kinase-like 7
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
76.6 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cell Adhesion
Relevance
Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in bryogenesis, epithelial tissue organization and angiogenesis.
Biologically Active
Not Test
Expression Region
31-704aa
Protein Length
Extracellular Domain
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis.
Subcellular Location
Membrane, Single-pass type I membrane protein, Cell junction
Tissue Specificity
Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen