« Zurück
Startseite /
Recombinant Human Inactive tyrosine-protein kinase 7 (PTK7),partial

Recombinant Human Inactive tyrosine-protein kinase 7 (PTK7),partial

ArtNr	CSB-YP622651HU-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human (Homo sapiens)
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYW LLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQ CVARDDVTGEEARSANASFNIKWIEAGPVVLKHPA SEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLS DGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSA FGQACSSQNFTLSIADESFARVVLAPQDVVVARYE EAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHL RRA
Protein Familie	Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily
Citations	Colon carcinoma kinase-4 defines a new subclass of the receptor tyrosine kinase family.Mossie K., Jallal B., Alves F., Sures I., Plowman G.D., Ullrich A.Oncogene 11:2179-2184(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Colon carcinoma kinase 4 ;CCK-4Protein-tyrosine kinase 7Pseudo tyrosine kinase receptor 7Tyrosine-protein kinase-like 7
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	76.6 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Cell Adhesion
Relevance	Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in bryogenesis, epithelial tissue organization and angiogenesis.
Biologically Active	Not Test
Expression Region	31-704aa
Protein Length	Extracellular Domain
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis.
Subcellular Location	Membrane, Single-pass type I membrane protein, Cell junction
Tissue Specificity	Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP622651HU-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern