« Zurück
Startseite /
Recombinant Human Diacylglycerol kinase alpha(DGKA)

Recombinant Human Diacylglycerol kinase alpha(DGKA)

ArtNr	CSB-EP006832HU-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human (Homo sapiens)
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFE DGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSL LEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSV SQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQ CAM
Protein Familie	Eukaryotic diacylglycerol kinase family
Citations	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project TeamGenome Res. 14:2121-2127(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	80KDA diacylglycerol kinase; Diglyceride kinase alpha
Lieferbar
Manufacturer - Targets	DGKA
Manufacturer - Conjugate / Tag	N-terminal 6XHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	86.6 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Signal Transduction
Relevance	Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity.
Biologically Active	Not Test
Expression Region	1-735aa
Protein Length	Full Length
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity.
Tissue Specificity	Lymphocytes and oligodendroglial cells.
Paythway	OxidativePhosphorylation

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP006832HU-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern