« Zurück
Startseite /
Recombinant Human Diacylglycerol kinase alpha(DGKA)

Recombinant Human Diacylglycerol kinase alpha(DGKA)

ArtNr	CSB-EP006832HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFE DGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSL LEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSV SQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQ CAM
Protein Familie	Eukaryotic diacylglycerol kinase family
Citations	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project TeamGenome Res. 14:2121-2127(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	80KDA diacylglycerol kinase; Diglyceride kinase alpha
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6XHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	86.6 kDa
General Research Areas	Signal Transduction
Relevance	Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity.
Expression Region	1-735aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity.
Tissue Specificity	Lymphocytes and oligodendroglial cells.
Paythway	OxidativePhosphorylation
Gene Names	DGKA
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP006832HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern