« Zurück
Startseite /
Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)

Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)

ArtNr	CSB-EP009681BO-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Metabolism Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GLAAAASARASSWWAHVEMGPPDPILGVTEAFKRD TNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA KNLDKEYLPIAGLAEFCKASAELALGENNEVLKSG RYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPK PTWGNHTPIFRDAGMQLQSYRYYDPKTCGFDFTGA IEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEM ATVVKKNNLFAFFDMAYQGFASGDGNKDAWAVRHF IEQ
Protein Familie	Class-I pyridoxal-phosphate-dependent aminotransferase family
Citations	Nucleotide sequence of a cDNA coding for bovine mitochondrial aspartate aminotransferase.Palmisano A., Aurilia V., Ferrara L., Cubellis M.V., Sannia G., Marino G.Int. J. Biochem. Cell Biol. 27:507-511(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fatty acid-binding protein; Short name:; FABP-1; Glutamate oxaloacetate transaminase 2; Kynurenine aminotransferase 4; Kynurenine aminotransferase IV; Kynurenine--oxoglutarate transaminase 4; Kynurenine--oxoglutarate transaminase IV; Plasma membrane-associated fatty acid-binding protein; Short name:; FABPpm; Transaminase A
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	61.5 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Metabolism
Relevance	Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids (By similarity).
Expression Region	20-430aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids (By similarity).
Subcellular Location	Mitochondrion matrix, Cell membrane
Gene Names	GOT2
Sequence Info	Full Length of Mature Protein
Organism	Bos taurus (Bovine)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP009681BO-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 28.08.2025