« Zurück
Home /
Recombinant Human 3-hydroxy-3-methylglutaryl-coenzyme A reductase(HMGCR),partial

Recombinant Human 3-hydroxy-3-methylglutaryl-coenzyme A reductase(HMGCR),partial

Hersteller	Cusabio
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP010565HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Metabolism
Target / Protein	HMGCR
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P04035
AA Sequence	MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAF DSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGM NMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKK PAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEA MIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYI ACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTM PSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPG ENARQLARIVCGTVMAGELSLMAALAAGHLVKSHM IHNRSKINLQDLQGACTKKT
Tag Info	N-terminal 6xHis-tagged
Expression Region	588-887aa
Protein length	Partial
MW	36 kDa
Relevance	Transmbrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.
References	The UBIAD1 prenyltransferase links menaquione-4 synthesis to cholesterol metabolic enzymes.Nickerson M.L., Bosley A.D., Weiss J.S., Kostiha B.N., Hirota Y., Brandt W., Esposito D., Kinoshita S., Wessjohann L., Morham S.G., Andresson T., Kruth H.S., Okano T., Dean M.Hum. Mutat. 34:317-329(2013)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.
Subcellular Location	Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families	HMG-CoA reductase family
Paythway	AMPKSignaling
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP010565HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen