Comparison

Recombinant Human 3-hydroxy-3-methylglutaryl-coenzyme A reductase(HMGCR),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010565HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAF DSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGM NMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKK PAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEA MIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYI ACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTM PSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPG ENARQLARIVCGTVMAGELSLMAALAAGHLVKSHM IHNRSKINLQDLQGACTKKT
Research Topic
Metabolism
Uniprot ID
P04035
Gene Names
HMGCR
Tag Info
N-terminal 6xHis-tagged
Expression Region
588-887aa
MW of Fusion Proten
36
Sequence Info
Partial
Relevance
Transmbrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.
Reference
The UBIAD1 prenyltransferase links menaquione-4 synthesis to cholesterol metabolic enzymes.Nickerson M.L., Bosley A.D., Weiss J.S., Kostiha B.N., Hirota Y., Brandt W., Esposito D., Kinoshita S., Wessjohann L., Morham S.G., Andresson T., Kruth H.S., Okano T., Dean M.Hum. Mutat. 34:317-329(2013)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close