« Back
Home /
Recombinant Human 3-hydroxy-3-methylglutaryl-coenzyme A reductase(HMGCR),partial

Recombinant Human 3-hydroxy-3-methylglutaryl-coenzyme A reductase(HMGCR),partial

Manufacturer	Cusabio
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP010565HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Metabolism
Target / Protein	HMGCR
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P04035
AA Sequence	MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAF DSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGM NMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKK PAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEA MIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYI ACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTM PSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPG ENARQLARIVCGTVMAGELSLMAALAAGHLVKSHM IHNRSKINLQDLQGACTKKT
Tag Info	N-terminal 6xHis-tagged
Expression Region	588-887aa
Protein length	Partial
MW	36 kDa
Relevance	Transmbrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.
References	The UBIAD1 prenyltransferase links menaquione-4 synthesis to cholesterol metabolic enzymes.Nickerson M.L., Bosley A.D., Weiss J.S., Kostiha B.N., Hirota Y., Brandt W., Esposito D., Kinoshita S., Wessjohann L., Morham S.G., Andresson T., Kruth H.S., Okano T., Dean M.Hum. Mutat. 34:317-329(2013)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.
Subcellular Location	Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families	HMG-CoA reductase family
Paythway	AMPKSignaling
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP010565HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time