« Zurück
Home /
Recombinant Human Modulator of apoptosis 1(MOAP1)

Recombinant Human Modulator of apoptosis 1(MOAP1)

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer Testicular & Prostate Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP014693HU-50
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cell Biology
Uniprot ID	Q96BY2
Gene Names	MOAP1
Organism	Homo sapiens (Human)
AA Sequence	MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEI EEALQAGLAPLGEYRLLGRMFRRDENRKVALVGLT AETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSR LNEFLAGEGMTVGELSRALGHENGSLDPEQGMIPE MWAPMLAQALEALQPALQCLKYKKLRVFSGRESPE PGEEEFGRWMFHTTQMIKAWQVPDVEKRRRLLESL RGPALDVIRVLKINNPLITVDECLQALEEVFGVTD NPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLV QRGAIERDAVNQARLDQVIAGAVHKTIRRELNLPE DGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNF
Expression Region	1-351aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	66.5 kDa
Alternative Name(s)	Paraneoplastic antigen Ma4
Relevance	Required for death receptor-dependent apoptosis. When associated with RASSF1, promotes BAX conformational change and translocation to mitochondrial membranes in response to TNF and TNFSF10 stimulation.
Reference	"MAP-1, a novel proapoptotic protein containing a BH3-like motif that associates with Bax through its Bcl-2 homology domains." Tan K.O., Tan K.M.L., Chan S.-L., Yee K.S.Y., Bevort M., Ang K.C., Yu V.C. J. Biol. Chem. 276:2802-2807(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for death receptor-dependent apoptosis. When associated with RASSF1, promotes BAX conformational change and translocation to mitochondrial membranes in response to TNF and TNFSF10 stimulation.
Protein Families	PNMA family
Tissue Specificity	Widely expressed, with high levels in heart and brain.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen