« Zurück
Startseite /
Recombinant Mouse Prohibitin(Phb),partial

Recombinant Mouse Prohibitin(Phb),partial

ArtNr	CSB-EP017885MO2-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRN VPVITGSKDLQNVNITLRILFRPVASQLPRIYTSI GEDYDERVLPSITTEILKSVVARFDAGELITQREL VSRQVSDDLTERAATFGLILDDVSLTHL
Protein Familie	Prohibitin family
Citations	"The IgM antigen receptor of B lymphocytes is associated with prohibitin and a prohibitin-related protein." Terashima M., Kim K.-M., Adachi T., Nielsen P.J., Reth M., Koehler G., Lamers M.C. EMBO J. 13:3782-3792(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	B-cell receptor-associated protein 32 (BAP 32)
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	20.5 kDa
General Research Areas	Transcription
Relevance	Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging
Expression Region	41-173aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging (By similarity).
Subcellular Location	Mitochondrion inner membrane
Tissue Specificity	Widely expressed in different tissues.
Biologically active	Not Test
Protein length	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP017885MO2-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern