Comparison

Recombinant Mouse Prohibitin(Phb),partial

Item no. CSB-EP017885MO2-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRN VPVITGSKDLQNVNITLRILFRPVASQLPRIYTSI GEDYDERVLPSITTEILKSVVARFDAGELITQREL VSRQVSDDLTERAATFGLILDDVSLTHL
Protein Family Prohibitin family
Citations "The IgM antigen receptor of B lymphocytes is associated with prohibitin and a prohibitin-related protein."
Terashima M., Kim K.-M., Adachi T., Nielsen P.J., Reth M., Koehler G., Lamers M.C.
EMBO J. 13:3782-3792(1994)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias B-cell receptor-associated protein 32 (BAP 32)
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
20.5 kDa
General Research Areas
Transcription
Relevance
Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging
Expression Region
41-173aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging (By similarity).
Subcellular Location
Mitochondrion inner membrane
Tissue Specificity
Widely expressed in different tissues.
Biologically active
Not Test
Protein length
Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close