« Zurück
Startseite /
Recombinant Human Signal recognition particle 54 kDa protein(SRP54)

Recombinant Human Signal recognition particle 54 kDa protein(SRP54)

ArtNr	CSB-EP022675HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MVLADLGRKITSALRSLSNATIINEEVLNAMLKEV CTALLEADVNIKLVKQLRENVKSAIDLEEMASGLN KRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIM FVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTF RAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEG VEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVAN AIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASV IVT
Protein Familie	GTP-binding SRP family, SRP54 subfamily
Citations	"Sequence of the highly conserved gene encoding the human 54kDa subunit of signal recognition particle." Patel S., Austen B. DNA Seq. 6:167-170(1996)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-B2M-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	69.7 kDa
General Research Areas	Signal Transduction
Relevance	Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).
Expression Region	1-504aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).
Subcellular Location	Nucleus speckle, Cytoplasm
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP022675HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern