« Back
Home /
Recombinant Human Signal recognition particle 54 kDa protein(SRP54)

Recombinant Human Signal recognition particle 54 kDa protein(SRP54)

Item no.	CSB-EP022675HU-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MVLADLGRKITSALRSLSNATIINEEVLNAMLKEV CTALLEADVNIKLVKQLRENVKSAIDLEEMASGLN KRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIM FVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTF RAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEG VEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVAN AIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASV IVT
Protein Family	GTP-binding SRP family, SRP54 subfamily
Citations	"Sequence of the highly conserved gene encoding the human 54kDa subunit of signal recognition particle." Patel S., Austen B. DNA Seq. 6:167-170(1996)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-B2M-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	69.7 kDa
General Research Areas	Signal Transduction
Relevance	Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).
Expression Region	1-504aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).
Subcellular Location	Nucleus speckle, Cytoplasm
Biologically active	Not Test
Protein length	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP022675HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer