Vergleich

Recombinant Saccharomyces cerevisiae Probable tRNA threonylcarbamoyladenosine biosynthesis protein KAE1(KAE1)

ArtNr CSB-EP330543SVG-200
Hersteller Cusabio
Menge 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MVNLNTIPPKNGRDYYIALGLEGSANKLGVGIVKH PLLPKHANSDLSYDCEAEMLSNIRDTYVTPPGEGF LPRDTARHHRNWCIRLIKQALAEADIKSPTLDIDV ICFTKGPGMGAPLHSVVIAARTCSLLWDVPLVGVN HCIGHIEMGREITKAQNPVVLYVSGGNTQVIAYSE KRYRIFGETLDIAIGNCLDRFARTLKIPNEPSPGY NIEQLAKKAPHKENLVELPYTVKGMDLSMSGILAS IDL
Protein Familie KAE1 / TsaD family
Citations "Sequencing and comparison of yeast species to identify genes and regulatory elements."Kellis M., Patterson N., Endrizzi M., Birren B.W., Lander E.S.Nature 423:241-254(2003)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Kinase-associated endopeptidase 1; N6-L-threonylcarbamoyladenine synthase; Short name:; t(6)A synthase; t(6)A37 threonylcarbamoyladenosine biosynthesis protein KAE1; tRNA threonylcarbamoyladenosine biosynthesis protein KAE1
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
46.7 kDa
Relevance
Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.
Expression Region
1-386aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.
Subcellular Location
Cytoplasm, Nucleus
Gene Names
KAE1
Sequence Info
Full Length
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 28.08.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen