« Zurück
Startseite /
Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein(pal)

Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein(pal)

ArtNr	CSB-EP340792LNY-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEP GESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQA EYLKTHPGARVMIAGHTDERGSREYNVALGERRAD TVAEILRMAGVSRQQIRVVSYGKERPANYGHDEAS HAQNRRVEFIYEATR
Protein Familie	OmpA family, Pal subfamily
Citations	"Cloning, genetic analysis, and nucleotide sequence of a determinant coding for a 19-kilodalton peptidoglycan-associated protein (Ppl) of Legionella pneumophila."Ludwig B., Schmid A., Marre R., Hacker J.Infect. Immun. 59:2515-2521(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	19KDA surface antigen; PPL
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	20.8 kDa
Relevance	Very strongly associated with the peptidoglycan.
Expression Region	22-176aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Very strongly associated with the peptidoglycan.
Subcellular Location	Cell outer membrane, Lipid-anchor
Gene Names	pal
Sequence Info	Full Length of Mature Protein
Organism	Legionella pneumophila
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP340792LNY-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 28.08.2025