Vergleich

Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5?2.5?

ArtNr CSB-EP366021EEB-100
Hersteller Cusabio
Menge 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Konjugat/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPR GVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAV EEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTT FKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDV PIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESV MLVELATFGGGEDDWADEVEENGYVASGSAKASKP RDEESWDEDDEESEEADEDGDF
Citations Sequence of bacteriophage T3 DNA from gene 2.5 through gene 9.Beck P.J., Gonzalez S., Ward C.L., Molineux I.J.J. Mol. Biol. 210:687-701(1989)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Single-stranded DNA-binding protein ;SSB protein
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
41.9 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Helix-destabilizing protein, which is expressed in the late stage of lytic development, binds preferentially to single-stranded DNA. It is implicated in DNA replication, recombination, and repair.
Expression Region
1-232aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.
Gene Names
2, 5
Sequence Info
Full Length
Organism
Enterobacteria phage T3 (Bacteriophage T3)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen