« Zurück
Home /
Recombinant Human Oligodendrocyte transcription factor 2(OLIG2)

Recombinant Human Oligodendrocyte transcription factor 2(OLIG2)

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Peptides & Proteins Recombinant Proteins Neuronal Cell Markers
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	100ug
Host	E.coli
ArtNr	CSB-EP623814HU-100
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q13516
Gene Names	OLIG2
Organism	Homo sapiens (Human)
AA Sequence	MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFT GGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKL GGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPE LQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG PSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSE IYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAH AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPG SGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG ASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSL PRLTSDAK
Expression Region	1-323aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	48.4 kDa
Alternative Name(s)	Class B basic helix-loop-helix protein 1 Short name: bHLHb1 Class E basic helix-loop-helix protein 19 Short name: bHLHe19 Protein kinase C-binding protein 2 Protein kinase C-binding protein RACK17
Relevance	Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube. Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development
Reference	Protein kinase C-binding protein.Kuroda S., Tokunaga C., Kiyohara Y., Konishi H., Kikkawa U.Submitted (FEB-1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube. Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development (By similarity).
Involvement in disease	A chromosomal aberration involving OLIG2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(14; 21)(q11.2; q22) with TCRA.
Subcellular Location	Nucleus, Cytoplasm
Tissue Specificity	Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas highly variable.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP623814HU-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen