Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
100ug |
Host |
E.coli |
Item no. |
CSB-EP623814HU-100 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Areas |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q13516 |
Gene Names |
OLIG2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFT GGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKL GGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPE LQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG PSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSE IYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAH AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPG SGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG ASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSL PRLTSDAK |
Expression Region |
1-323aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
48.4 kDa |
Alternative Name(s) |
Class B basic helix-loop-helix protein 1 Short name: bHLHb1 Class E basic helix-loop-helix protein 19 Short name: bHLHe19 Protein kinase C-binding protein 2 Protein kinase C-binding protein RACK17 |
Relevance |
Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube. Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development |
Reference |
Protein kinase C-binding protein.Kuroda S., Tokunaga C., Kiyohara Y., Konishi H., Kikkawa U.Submitted (FEB-1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube. Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development (By similarity). |
Involvement in disease |
A chromosomal aberration involving OLIG2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(14; 21)(q11.2; q22) with TCRA. |
Subcellular Location |
Nucleus, Cytoplasm |
Tissue Specificity |
Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas highly variable. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.