« Zurück
Startseite /
Recombinant Mouse Serum response factor(Srf)

Recombinant Mouse Serum response factor(Srf)

ArtNr	CSB-EP881354MO-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Neuronal Cell Markers
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MLPSQAGAAAALGRGSALGGNLNRTPTGRPGGGGG TRGANGGRVPGNGAGLGQSRLEREAAAAAAPTAGA LYSGSEGDSESGEEEELGAERRGLKRSLSEMELGV VVGGPEAAAAAAGGYGPVSGAVSGAKPGKKTRGRV KIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLT GTQVLLLVASETGHVYTFATRKLQPMITSETGKAL IQTCLNSPDSPPRSDPTTDQRMSATGFEEPDLTYQ VSE
Citations	"Identification of a novel serum response factor cofactor in cardiac gene regulation."Zhang X., Azhar G., Zhong Y., Wei J.Y.J. Biol. Chem. 279:55626-55632(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:SRF
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	67.2 kDa
General Research Areas	Cardiovascular
Relevance	SRF is a transcription factor that binds to the serum response element (SRE), a short sequence of dyad symmetry located 300 bp to the 5' of the site of transcription initiation of some genes (such as FOS) (By similarity). Required for cardiac differentiation and maturation.
Expression Region	1-504aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	SRF is a transcription factor that binds to the serum response element (SRE), a short sequence of dyad symmetry located 300 bp to the 5' of the site of transcription initiation of some genes (such as FOS) (By similarity). Required for cardiac differentiation and maturation.
Subcellular Location	Nucleus
Gene Names	Srf
Sequence Info	Full Length
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP881354MO-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern