« Zurück
Startseite /
Recombinant Pig Parathyroid hormone(PTH)

Recombinant Pig Parathyroid hormone(PTH)

ArtNr	CSB-MP018987PI-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Thyroid Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Mammalian cells
Konjugat/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESD KGWASAPTSGKPRKEKASGKLYPESGEDTGSRHQG RPCLPEWDHILCWP
Protein Familie	G-protein coupled receptor 2 family
Citations	Mapping of chimpanzee full-length cDNAs onto the human genome unveils large potential divergence of the transcriptome.Sakate R., Suto Y., Imanishi T., Tanoue T., Hida M., Hayasaka I., Kusuda J., Gojobori T., Hashimoto K., Hirai M.Gene 399:1-10(2007)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GTR2-2; Intestinal protein OCI-5; MXR7
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	13.6 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Signal Transduction
Relevance	Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition (By similarity).
Expression Region	32-115aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.
Subcellular Location	Cell membrane, Multi-pass membrane protein
Gene Names	PTH
Sequence Info	Full Length of Mature Protein
Organism	Sus scrofa (Pig)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP018987PI-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern