Vergleich

Recombinant Pig Parathyroid hormone(PTH)

ArtNr CSB-MP018987PI-50
Hersteller Cusabio
Menge 50 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Mammalian cells
Konjugat/Tag Myc, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESD KGWASAPTSGKPRKEKASGKLYPESGEDTGSRHQG RPCLPEWDHILCWP
Protein Familie G-protein coupled receptor 2 family
Citations "Mapping of chimpanzee full-length cDNAs onto the human genome unveils large potential divergence of the transcriptome."Sakate R., Suto Y., Imanishi T., Tanoue T., Hida M., Hayasaka I., Kusuda J., Gojobori T., Hashimoto K., Hirai M.Gene 399:1-10(2007)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias GTR2-2; Intestinal protein OCI-5; MXR7
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
13.6 kDa
General Research Areas
Signal Transduction
Relevance
Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition (By similarity).
Expression Region
32-115aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.
Subcellular Location
Cell membrane, Multi-pass membrane protein
Gene Names
PTH
Sequence Info
Full Length of Mature Protein
Organism
Sus scrofa (Pig)
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen