« Zurück
Startseite /
Recombinant Bovine Pentraxin-related protein PTX3(PTX3)

Recombinant Bovine Pentraxin-related protein PTX3(PTX3)

ArtNr	CSB-MP610820BO-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Mammalian cells
Konjugat/Tag	FLAG, Myc
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ENSDDYELMYVNLDNEIDNGLHPTEDPTPCDCSRE NSEWDKLFTMLENSQMREGMLLQATDVMLRGELQK LQAELGRLEGSLQKLCGPEAPSETRLARALDDLLQ ASRDAGRRLARLEDAGALRPQEEAGRALGAVLEEL RRTRADLRAVQGWAASRWLPAGCETAILFPMRSKK IFASVHPVTPMKLETFSACIWVKATEVLNKTVLFS YGTKRNPYEIQLYLSYRSIMLVVGGEENRLVADAV ISL
Citations	NIH - Mammalian Gene Collection (MGC) project Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Pentaxin-related protein PTX3
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal Flag-Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	44.7 kDa
Relevance	Plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.
Expression Region	18-382aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.
Subcellular Location	Secreted
Gene Names	PTX3
Sequence Info	Full Length of Mature Protein
Organism	Bos taurus (Bovine)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP610820BO-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern