« Back
Home /
Recombinant Bovine Pentraxin-related protein PTX3(PTX3)

Recombinant Bovine Pentraxin-related protein PTX3(PTX3)

Item no.	CSB-MP610820BO-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Mammalian cells
Conjugate/Tag	FLAG, Myc
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ENSDDYELMYVNLDNEIDNGLHPTEDPTPCDCSRE NSEWDKLFTMLENSQMREGMLLQATDVMLRGELQK LQAELGRLEGSLQKLCGPEAPSETRLARALDDLLQ ASRDAGRRLARLEDAGALRPQEEAGRALGAVLEEL RRTRADLRAVQGWAASRWLPAGCETAILFPMRSKK IFASVHPVTPMKLETFSACIWVKATEVLNKTVLFS YGTKRNPYEIQLYLSYRSIMLVVGGEENRLVADAV ISL
Citations	NIH - Mammalian Gene Collection (MGC) project Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Pentaxin-related protein PTX3
Available
Manufacturer - Conjugate / Tag	N-terminal Flag-Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	44.7 kDa
Relevance	Plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.
Expression Region	18-382aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.
Subcellular Location	Secreted
Gene Names	PTX3
Sequence Info	Full Length of Mature Protein
Organism	Bos taurus (Bovine)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP610820BO-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer