Vergleich

Recombinant Norwalk virus Capsid protein VP1(ORF2)

ArtNr CSB-MP767779NBAY-10
Hersteller Cusabio
Menge 10 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Mammalian cells
Konjugat/Tag FLAG, Myc
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MMMASKDATSSVDGASGAGQLVPEVNASDPLAMDP VAGSSTAVATAGQVNPIDPWIINNFVQAPQGEFTI SPNNTPGDVLFDLSLGPHLNPFLLHLSQMYNGWVG NMRVRIMLAGNAFTAGKIIVSCIPPGFGSHNLTIA QATLFPHVIADVRTLDPIEVPLEDVRNVLFHNNDR NQQTMRLVCMLYTPLRTGGGTGDSFVVAGRVMTCP SPDFNFLFLVPPTVEQKTRPFTLPNLPLSSLSNSR APL
Protein Familie Caliciviridae capsid protein family
Citations X-ray crystallographic structure of the Norwalk virus capsid.Prasad B.V.V., Hardy M.E., Dokland T., Bella J., Rossmann M.G., Estes M.K.Science 286:287-290(1999)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias p59
Lieferbar
Manufacturer - Targets
ORF2
Manufacturer - Conjugate / Tag
C-terminal Flag-Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
59.6 kDa
Relevance
Capsid protein self assbles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assbled as icosahedron with T=1 symmetry. The capsid encapsulate the genomic RNA and VP2 proteins. Attaches virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells.
Expression Region
1-530aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Capsid protein self assembles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assembled as icosahedron with T=1 symmetry. The capsid encapsulate the genomic RNA and VP2 proteins. Attaches virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells.
Subcellular Location
Virion, Host cytoplasm
Biologically active
Not Test
Protein length
Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen