« Back
Home /
Recombinant Norwalk virus Capsid protein VP1(ORF2)

Recombinant Norwalk virus Capsid protein VP1(ORF2)

Item no.	CSB-MP767779NBAY-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Mammalian cells
Conjugate/Tag	FLAG, Myc
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MMMASKDATSSVDGASGAGQLVPEVNASDPLAMDP VAGSSTAVATAGQVNPIDPWIINNFVQAPQGEFTI SPNNTPGDVLFDLSLGPHLNPFLLHLSQMYNGWVG NMRVRIMLAGNAFTAGKIIVSCIPPGFGSHNLTIA QATLFPHVIADVRTLDPIEVPLEDVRNVLFHNNDR NQQTMRLVCMLYTPLRTGGGTGDSFVVAGRVMTCP SPDFNFLFLVPPTVEQKTRPFTLPNLPLSSLSNSR APL
Protein Family	Caliciviridae capsid protein family
Citations	X-ray crystallographic structure of the Norwalk virus capsid.Prasad B.V.V., Hardy M.E., Dokland T., Bella J., Rossmann M.G., Estes M.K.Science 286:287-290(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	p59
Available
Manufacturer - Targets	ORF2
Manufacturer - Conjugate / Tag	C-terminal Flag-Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	59.6 kDa
Relevance	Capsid protein self assbles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assbled as icosahedron with T=1 symmetry. The capsid encapsulate the genomic RNA and VP2 proteins. Attaches virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells.
Expression Region	1-530aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Capsid protein self assembles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assembled as icosahedron with T=1 symmetry. The capsid encapsulate the genomic RNA and VP2 proteins. Attaches virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells.
Subcellular Location	Virion, Host cytoplasm
Biologically active	Not Test
Protein length	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP767779NBAY-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer