« Zurück
Startseite /
Recombinant Saccharomyces cerevisiae Cystathionine beta-synthase(CYS4)

Recombinant Saccharomyces cerevisiae Cystathionine beta-synthase(CYS4)

ArtNr	CSB-YP004589SVG-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MTKSEQQADSRHNVIDLVGNTPLIALKKLPKALGI KPQIYAKLELYNPGGSIKDRIAKSMVEEAEASGRI HPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLP EKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHIG VAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREI QRQLEDLNLFDNLRAVVAGAGTGGTISGISKYLKE QNDKIQIVGADPFGSILAQPENLNKTDITDYKVEG IGY
Protein Familie	Cysteine synthase/cystathionine beta-synthase family
Citations	Cysteine biosynthesis in Saccharomyces cerevisiae occurs through the transsulfuration pathway which has been built up by enzyme recruitment.Cherest H., Thomas D., Surdin-Kerjan Y.J. Bacteriol. 175:5366-5374(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Beta-thionase;Serine sulfhydrase;Sulfur transfer protein 4
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	58 kDa
Expression Region	1-507aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	CYS4
Sequence Info	Full Length
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP004589SVG-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 28.08.2025