« Zurück
Startseite /
Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial

Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial

ArtNr	CSB-YP009514RA1-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLL ATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPW ASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSEC EESKQGERN
Protein Familie	G-protein coupled receptor 2 family
Citations	"Expression cloning of the pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1."Thorens B.Proc. Natl.Acad. Sci. U.S.A. 89:8641-8645(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	15.1 kDa
General Research Areas	Neuroscience
Relevance	This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Expression Region	22-135aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)
Subcellular Location	Cell membrane, Multi-pass membrane protein
Tissue Specificity	Pancreatic islets, stomach, lung, rat insulinoma cell line.
Gene Names	Glp1r
Sequence Info	Partial
Organism	Rattus norvegicus (Rat)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP009514RA1-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern