« Zurück
Startseite /
Recombinant Human Hyaluronidase-1(HYAL1)

Recombinant Human Hyaluronidase-1(HYAL1)

ArtNr	CSB-YP623651HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	FRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVF DVVANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEP VFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLA VIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPD WPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPR GLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQ LGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRV AEA
Protein Familie	Glycosyl hydrolase 56 family
Citations	Structure of human hyaluronidase-1, a hyaluronan hydrolyzing enzyme involved in tumor growth and angiogenesis.Chao K.L., Muthukumar L., Herzberg O.Biochemistry 46:6911-6920(2007)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Hyaluronoglucosaminidase-1Lung carcinoma protein 1 ;LuCa-1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	48.1 kDa
General Research Areas	Cancer
Relevance	May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth.
Expression Region	22-435aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth.
Subcellular Location	Secreted, Lysosome
Tissue Specificity	Highly expressed in the liver, kidney and heart. Weakly expressed in lung, placenta and skeletal muscle. No expression detected in adult brain. Isoform 1 is expressed only in bladder and prostate cancer cells, G2/G3 bladder tumor tissues and lymph node specimens showing tumor invasive tumors cells. Isoform 3, isoform 4, isoform 5 and isoform 6 are expressed in normal bladder and bladder tumor tissues.
Involvement in disease	Mucopolysaccharidosis 9 (MPS9)
Gene Names	HYAL1
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP623651HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern