« Back
Home /
Recombinant Human Hyaluronidase-1(HYAL1)

Recombinant Human Hyaluronidase-1(HYAL1)

Item no.	CSB-YP623651HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	FRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVF DVVANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEP VFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLA VIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPD WPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPR GLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQ LGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRV AEA
Protein Family	Glycosyl hydrolase 56 family
Citations	Structure of human hyaluronidase-1, a hyaluronan hydrolyzing enzyme involved in tumor growth and angiogenesis.Chao K.L., Muthukumar L., Herzberg O.Biochemistry 46:6911-6920(2007)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Hyaluronoglucosaminidase-1Lung carcinoma protein 1 ;LuCa-1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	48.1 kDa
General Research Areas	Cancer
Relevance	May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth.
Expression Region	22-435aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth.
Subcellular Location	Secreted, Lysosome
Tissue Specificity	Highly expressed in the liver, kidney and heart. Weakly expressed in lung, placenta and skeletal muscle. No expression detected in adult brain. Isoform 1 is expressed only in bladder and prostate cancer cells, G2/G3 bladder tumor tissues and lymph node specimens showing tumor invasive tumors cells. Isoform 3, isoform 4, isoform 5 and isoform 6 are expressed in normal bladder and bladder tumor tissues.
Involvement in disease	Mucopolysaccharidosis 9 (MPS9)
Gene Names	HYAL1
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP623651HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer