MT-CYB Rabbit pAb

ArtNr	A9762-500uL
Hersteller	Abclonal
Menge	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	NMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLY
NCBI	mt-Cytb
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CYTB, MT-CYB
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background	Predicted to enable metal ion binding activity and ubiquinol-cytochrome-c reductase activity. Predicted to be involved in several processes, including electron transport coupled proton transport; mitochondrial electron transport, ubiquinol to cytochrome c; and response to glucagon. Located in membrane and mitochondrion. Is integral component of mitochondrial inner membrane. Human ortholog(s) of this gene implicated in ovarian carcinoma and urinary bladder cancer. Orthologous to human MT-CYB (mitochondrially encoded cytochrome b).
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 3-103 of mouse MT-CYB (NP_904340.1).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	43kDa
Route	Synthetic peptide
Manufacturer - Research Area	Signal Transduction, Endocrine & Metabolism, Mitochondrial metabolism, Cytochromes, Neuroscience, Neurodegenerative Diseases

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A9762-500uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 uL

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern