« Zurück
Startseite /
Recombinant Mouse CXCL13/BLC Protein

Recombinant Mouse CXCL13/BLC Protein

ArtNr	RP02941LQ-100ug
Hersteller	Abclonal
Menge	100 ug
Quantity options	1000 ug 100 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95% as determined by HPLC.
Dry ice	Yes
Sequence	ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
NCBI	CXCL13/BLC
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ANGIE,ANGIE2,BCA-1,BCA1,BLC,BLR1L,SCYB13
Versandbedingung	Trockeneis
Lieferbar
Manufacturer - Applications	<1EU/μg
Manufacturer - Category	Proteins
Shipping Temperature	dry ice
Storage Conditions	Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight	11.7 kDa
Description	Recombinant Mouse CXCL13/BLC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Ala109) of mouse CXCL13/BLC (Accession #NP_061354.1) fused with 6×His tag at the N-terminus.
Background	Recent studies have implicated chemokines in microglial activation and pathogenesis of neuropathic pain. C-X-C motif chemokine 13 (CXCL13) is a B lymphocyte chemoattractant that activates CXCR5. Using the spinal nerve ligation (SNL) model of neuropathic pain, CXCL13 was persistently upregulated in spinal cord neurons after SNL, resulting in spinal astrocyte activation via CXCR5 in mice.
Immunogen	Ile22-Ala109
Route	N-His
Endotoxin	<1EU/μg
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
Protein Formulation	Supplied as a 0.22 μm filtered solution in 50mM Tris, 500mM NaCl, pH 7.5.
Expected Protein Size	11.7 kDa
Gene Symbol	CXCL13/BLC

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP02941LQ-100ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern