« Back
Home /
Recombinant Mouse CXCL13/BLC Protein

Recombinant Mouse CXCL13/BLC Protein

Item no.	RP02941LQ-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	1000 ug 100 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95% as determined by HPLC.
Dry ice	Yes
Sequence	ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
NCBI	CXCL13/BLC
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ANGIE,ANGIE2,BCA-1,BCA1,BLC,BLR1L,SCYB13
Shipping Condition	Dry ice
Available
Manufacturer - Applications	<1EU/μg
Manufacturer - Category	Proteins
Shipping Temperature	dry ice
Storage Conditions	Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight	11.7 kDa
Description	Recombinant Mouse CXCL13/BLC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Ala109) of mouse CXCL13/BLC (Accession #NP_061354.1) fused with 6×His tag at the N-terminus.
Background	Recent studies have implicated chemokines in microglial activation and pathogenesis of neuropathic pain. C-X-C motif chemokine 13 (CXCL13) is a B lymphocyte chemoattractant that activates CXCR5. Using the spinal nerve ligation (SNL) model of neuropathic pain, CXCL13 was persistently upregulated in spinal cord neurons after SNL, resulting in spinal astrocyte activation via CXCR5 in mice.
Immunogen	Ile22-Ala109
Route	N-His
Endotoxin	<1EU/μg
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
Protein Formulation	Supplied as a 0.22 μm filtered solution in 50mM Tris, 500mM NaCl, pH 7.5.
Expected Protein Size	11.7 kDa
Gene Symbol	CXCL13/BLC

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP02941LQ-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer