« Back
Home /
ARL6IP4 Rabbit pAb

ARL6IP4 Rabbit pAb

Item no.	A17154-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Cell Biology Cytoskeleton Immunohistochemistry Western Blot ELISA Primary Antibodies Immunostaining small GTPases Arf Subfamily
Type	Antibody Polyclonal
Applications	ELISA, IHC-P
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
NCBI	ARL6IP4
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SR-25,SRp25,SFRS20,SRrp37,ARL6IP4
Available
Manufacturer - Category	Polyclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	26kDa
Background	Enables identical protein binding activity. Predicted to be involved in RNA splicing and mRNA processing. Predicted to be located in nucleus.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 313-402 of human ARL6IP4 (NP_057722.3).
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, RNA Binding, Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Microfilaments.
Antigen Seq	SAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
Manufacturer - Gene ID (Human)	51329
Expected Protein Size	26kDa
Gene Symbol	ARL6IP4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A17154-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 12/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer