« Back
Home /
CD9 Rabbit mAb

CD9 Rabbit mAb

Item no.	A24130-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Quantity options	1000 uL 100 ul 20 ul 500 uL
Category	Neuroscience Aging & Neurological Disorders Antibodies Flow Cytometry Immunohistochemistry Immunoprecipitation Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Applications	WB, FC, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
NCBI	CD9
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	MIC3,MRP-1,BTCC-1,DRAP-27,TSPAN29,TSPAN-29,CD9
Available
Manufacturer - Category	Monoclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	25kDa
Background	This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-228 of human CD9(NP_001760.1).
Route	Recombinant protein
Manufacturer - Research Area	Cell Biology Developmental Biology, Immunology Inflammation, CDs, Stem Cells, Embryonic Stem Cells, Cardiovascular, Blood.
Antigen Seq	MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Manufacturer - Gene ID (Human)	928
Expected Protein Size	25kDa
Gene Symbol	CD9

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A24130-1000uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer