« Back
Home /
NHLH1 Rabbit mAb

NHLH1 Rabbit mAb

Item no.	A24160-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 20 ul 500 uL
Category	Antibodies Immunoprecipitation Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies CHiP Immunostaining Immunochemistry
Type	Antibody Monoclonal
Applications	WB, IP, ELISA, CHIP
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
NCBI	NHLH1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	HEN1,NSCL,NSCL1,bHLHa35,NHLH1
Available
Manufacturer - Category	Monoclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	15kDa
Background	The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human NHLH1 (NP_005589.1).
Recommended Dilution	WB, 1:1000 - 1:3000\|IP, 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells\|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.\|ChIP, 5μg antibody for 10μg-15μg of Chromatin
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Neuroscience.
Antigen Seq	MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH
Manufacturer - Gene ID (Human)	4807
Expected Protein Size	15kDa
Gene Symbol	NHLH1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A24160-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 11/6/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer