Comparison

SOX13 Rabbit pAb European Partner

Item no. A24507-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Applications WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI SOX13
Alias SOX13,ICA12,Sox-13,SRY-box 13
Available
Manufacturer - Category
Polyclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
69kDa
Background
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 525-600 of human SOX13 (NP_005677.2).
Recommended Dilution
WB, 1:1000 - 1:5000|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics & Nuclear Signaling, Transcription Factors, Signal Transduction, Neuroscience.
Antigen Seq
RQSYVIPPQAGQVQMSSSDVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYR
Expected Protein Size
69kDa
Gene Symbol
SOX13

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Delivery expected until 10/2/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close