Comparison

ALOX5 Rabbit mAb European Partner

Item no. A24617-500uL
Manufacturer Abclonal
Amount 500 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category
Applications WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI ALOX5
Alias 5-LO,5LPG,LOG5,5-LOX,ALOX5
Available
Manufacturer - Category
Monoclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
78kDa/71KDa/74KDa/61KDa/56KDa
Background
This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8, 11, 14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7, 9-trans-11, 14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ALOX5 (NP_000689.1) .
Route
Synthetic Peptide
Manufacturer - Research Area
Protein phosphorylation, Cancer, Signal Transduction, Endocrine Metabolism, Lipid Metabolism, Cardiovascular, Heart, Cardiovascular diseases, Heart disease.
Antigen Seq
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPC
Manufacturer - Gene ID (Human)
240
Expected Protein Size
78kDa/71KDa/74KDa/61KDa/56KDa
Gene Symbol
ALOX5

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close