Comparison

ABflo® 647 Rabbit anti-Mouse CD150/SLAM mAb European Partner

Item no. A24972-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 100 T 100 ul 200 T 20 ul 500 T
Applications FC
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Purity Affinity purification
NCBI Slamf1
Alias Slam,CD150,IPO-3,CDw150,ESTM51,4933415F16
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Manufacturer - Conjugate / Tag
ABflo® 647. Ex:648nm. Em:664nm.
Shipping Temperature
ice pack
Storage Conditions
Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight
38kDa
Background
Enables identical protein binding activity and signaling receptor activity. Involved in natural killer cell activation; positive regulation of activated T cell proliferation; and regulation of cytokine production. Acts upstream of or within several processes, including leukocyte chemotaxis involved in inflammatory response; positive regulation of leukocyte chemotaxis; and regulation of vesicle fusion. Located in external side of plasma membrane and phagocytic vesicle. Is expressed in liver lobe. Orthologous to human SLAMF1 (signaling lymphocytic activation molecule family member 1).
Manufacturer - Cross Reactivity
Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 25-242 of mouse CD150/SLAM (NP_038758.2).
Protein Size
38kDa
Route
Recombinant protein
Manufacturer - Research Area
Immunology, Cell Type Markers, CD, Non-lineage; Stem Cells, Hematopoietic Progenitors, Hematopoietic Stem Cells, HSC markers.
Antigen Seq
TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP
Manufacturer - Gene ID (Human)
6504
Expected Protein Size
38kDa
Gene Symbol
Slamf1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close