Comparison

ABflo® 488 Rabbit anti-Human CD8b mAb European Partner

Item no. A24986-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 100 T 100 ul 200 T 20 ul 500 T
Applications FC
Specific against Human (Homo sapiens)
Isotype IgG
Purity Affinity purification
NCBI CD8B
Alias LY3,P37,LEU2,LYT3,Ly-3,CD8B1,CD8beta
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Manufacturer - Conjugate / Tag
ABflo® 488. Ex:491nm. Em:516nm.
Shipping Temperature
ice pack
Storage Conditions
Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight
24kDa
Background
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified.
Manufacturer - Cross Reactivity
Human
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 22-170 of human CD8b (NP_004922.1).
Protein Size
24kDa
Route
Recombinant protein
Manufacturer - Research Area
Immunology Inflammation, CDs.
Antigen Seq
LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
Manufacturer - Gene ID (Human)
926
Expected Protein Size
24kDa
Gene Symbol
CD8B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close