Comparison

CaMKII Rabbit mAb European Partner

Item no. A25000-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Applications WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI CAMK2A/CAMK2B/CAMK2D/CAMK2G
Alias CAMKA,MRD53,MRT63,CaMKIIalpha,CaMKIINalpha,CaMKII
Available
Manufacturer - Category
Monoclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
54kDa/72kDa/56kDa/62kDa
Background
The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Several transcript variants encoding distinct isoforms have been identified for this gene.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMKII (NP_741960.1).
Recommended Dilution
WB, 1:500 - 1:1000|IP, 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Route
Synthetic peptide
Manufacturer - Research Area
Neuroscience; Neurotransmission; Calcium Signaling; Calmodulin / CaMKSignal; Transduction; Protein Phosphorylation; Ser / Thr Kinases; Other Kinases; Signal Transduction; Signaling Pathway; Calcium Signaling; Calmodulin Pathway.
Antigen Seq
GVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
Manufacturer - Gene ID (Human)
815/ 816/ 817/ 818
Expected Protein Size
54kDa/72kDa/56kDa/62kDa
Gene Symbol
CAMK2A/CAMK2B/CAMK2D/CAMK2G

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close