« Back
Home /
CBX7 Rabbit pAb

CBX7 Rabbit pAb

Item no.	A25023-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Applications	WB
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
NCBI	CBX7
Alias	CBX7
Available
Manufacturer - Category	Polyclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	28kDa
Background	This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 162-251 of human CBX7(NP_783640.1).
Route	Recombinant Protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Chromatin Remodeling.
Antigen Seq	NLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Manufacturer - Gene ID (Human)	23492
Expected Protein Size	28kDa
Gene Symbol	CBX7

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A25023-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer