« Back
Home /
FNDC5 Rabbit pAb

FNDC5 Rabbit pAb

Item no.	A25041-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Quantity options	1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Category	Oncology Metabolism Diabetes Glucose Homeostasis Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Myeloma Melanoma Sarcoma Obesity Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies By Organ Breast Cancer Immunostaining Immunochemistry
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
NCBI	FNDC5
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FRCP2,irisin,FNDC5
Available
Manufacturer - Category	Polyclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	24kDa
Background	This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is conserved as an AUG start codon in other organisms. Alternative splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity	Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 113-212 of human FNDC5 (NP_715637.2).
Recommended Dilution	WB, 1:1000 - 1:5000\|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Route	Synthetic peptide
Manufacturer - Research Area	Endocrine Metabolism, Endocrine and metabolic diseases, Obesity.
Antigen Seq	QSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
Manufacturer - Gene ID (Human)	252995
Expected Protein Size	24kDa
Gene Symbol	FNDC5

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A25041-1000uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 2/5/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer