Comparison

IL33 Rabbit pAb European Partner

Item no. A25253-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 uL 20 uL 500 uL
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI Il33
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Il-33,Il1f11,NF-HEV,9230117N10Rik,IL-33
Available
Manufacturer - Category
Polyclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
30kDa
Background
Enables cytokine activity and interleukin-33 receptor binding activity. Involved in several processes, including interleukin-33-mediated signaling pathway; microglial cell activation involved in immune response; and regulation of gene expression. Acts upstream of or within several processes, including negative regulation of macrophage proliferation; positive regulation of cellular defense response; and positive regulation of macromolecule metabolic process. Located in nucleus. Is expressed in several structures, including adrenal gland; alimentary system; genitourinary system; nervous system; and sensory organ. Used to study Alzheimer's disease. Human ortholog(s) of this gene implicated in candidiasis; inflammatory bowel disease; and peptic ulcer disease. Orthologous to human IL33 (interleukin 33).
Manufacturer - Cross Reactivity
Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 109-266 of mouse IL33(NP_598536.2).
Recommended Dilution
WB, 1:500 - 1:1000|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Route
Recombinant protein
Manufacturer - Research Area
Cardiovascular, Angiogenesis, Cytokines, Immunology, Innate Immunity, Cytokines, Interleukins.
Antigen Seq
SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Manufacturer - Gene ID (Human)
90865
Expected Protein Size
30kDa
Gene Symbol
Il33

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close