Comparison

PIK3CG Rabbit pAb European Partner

Item no. A25468-100uL
Manufacturer Abclonal
Amount 100 uL
Quantity options 1000 uL 100 uL 20 uL 500 uL
Category
Type Antibody Polyclonal
Applications ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI PIK3CG
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias PI3K,PIK3,IMD97,PI3CG,PI3Kgamma,p110gamma,p120-PI3K,PIK3CG
Available
Manufacturer - Category
Polyclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
126kDa
Background
Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I catalytic subunit of PI3K. Like other class I catalytic subunits (p110-alpha p110-beta, and p110-delta), the encoded protein binds a p85 regulatory subunit to form PI3K. This gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias. Several transcript variants encoding the same protein have been found for this gene.
Manufacturer - Cross Reactivity
Human
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 201-330 of human PIK3CG (NP_002640.2).
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Cancer, Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, G-Protein-Coupled Receptors Signaling to MAPK Erk, Kinase, PI3K-Akt Signaling Pathway, mTOR Signaling Pathway, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, MAPK-JNK Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Inhibition of Apoptosis, Autophagy, Cell Adhesion, Cytoskeleton, Microtubules, Actins, TGF-b-Smad Signaling Pathway, ESC Pluripotency and Differentiation, Endocrine Metabolism, Lipid Metabolism, AMPK Signaling Pathway, Warburg Effect, Immunology Inflammation, B Cell Receptor Signaling Pathway, T Cell Receptor Signaling Pathway, Jak-Stat-IL-6 Receptor Signaling Pathway, NF-kB Signaling Pathway, Toll-like Receptor Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway, TLR Signaling, Cardiovascular, Angiogenesis.
Antigen Seq
WVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCT
Manufacturer - Gene ID (Human)
5294
Expected Protein Size
126kDa
Gene Symbol
PIK3CG

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close