« Back
Home /
Nanog Rabbit mAb

Nanog Rabbit mAb

Item no.	A25887-100uL
Manufacturer	Abclonal
Amount	100 uL
Quantity options	100 uL 20 uL
Category	Antibodies Flow Cytometry Immunoprecipitation Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies CHiP Immunostaining Immunochemistry
Type	Antibody Monoclonal
Applications	WB, FC, ELISA, CHIP
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
NCBI	Nanog
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ENK,Stm1,ecat4,2410002E02Rik
Available
Manufacturer - Applications	ELISA, WB, ChIP, FC (intra)
Manufacturer - Category	Monoclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	34kDa
Background	The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Several transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 160-305 of mouse Nanog(NP_082292.1).
Route	Recombinant protein
Manufacturer - Research Area	Immunology Inflammation, CDs
Antigen Seq	LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI
Manufacturer - Gene ID (Human)	79923
Expected Protein Size	34kDa
Gene Symbol	Nanog

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A25887-100uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

available

Delivery expected until 11/6/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer