« Back
Home /
Fibronectin Rabbit pAb

Fibronectin Rabbit pAb

Item no.	A25907-20uL
Manufacturer	Abclonal
Amount	20 uL
Quantity options	1000 uL 100 uL 20 uL 500 uL
Category	Oncology Neuroscience Neural Adhesion Molecules Antibodies By Cell Type Cell Biology Cell Movement Cell Adhesion Immunohistochemistry Western Blot ELISA Immunofluorescence Immunocytochemistry Cell Stainings ECM Primary Antibodies Immunostaining Immunochemistry
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
NCBI	Fibronectin
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Fn,Fn-1,E330027I09
Available
Manufacturer - Category	Polyclonal Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Protein Weight	273kDa
Background	Enables peptidase activator activity. Acts upstream of or within several processes, including calcium-independent cell-matrix adhesion; cell-substrate junction assembly; and positive regulation of axon extension. Located in apical plasma membrane and basement membrane. Is expressed in several structures, including alimentary system; cardiovascular system; egg cylinder; embryo mesenchyme; and genitourinary system. Human ortholog(s) of this gene implicated in calcium oxalate nephrolithiasis; membranoproliferative glomerulonephritis; and spondylometaphyseal dysplasia corner fracture type. Orthologous to human FN1 (fibronectin 1).
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 2205-2477 of mouse Fibronectin (NP_034363.1).
Recommended Dilution	WB, 1:500 - 1:1000\|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Route	Recombinant protein
Manufacturer - Research Area	Cardiovascular Angiogenesis Adhesion / ECM Extracellular Matrix Signal Transduction Cytoskeleton / ECM Extracellular Matrix ECM Protein Fibronectin Stem Cell Lineage Labeling Ectodermal Stem Cells Neural Stem Cells Extracellular Stem Cells Mesenchymal Stem Cells Osteogenic Cancer Invasion / Microenvironment ECM Extracellular Matrix Other Developmental Biology Lineages Specifications Ectodermal.
Antigen Seq	ALSQTTISWTPFQESSEYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPIECFMPLDVQADRDDSRE
Manufacturer - Gene ID (Human)	2335
Expected Protein Size	273kDa
Gene Symbol	Fibronectin

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A25907-20uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 uL

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer